(data stored in ACNUC7421 zone)

EMBL: BA000030.PE500

BA000030.PE500       Location/Qualifiers
FT   CDS             641145..641333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_495"
FT                   /old_locus_tag="SAV_495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_495"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68205"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QL0"
FT                   /protein_id="BAC68205.1"
FT                   /translation="MARGGSITAEYGLEVLNTVIYLPRGEIFPITSSATLCNGFSRHRD
FT                   GSLQPPSHVGAGAVWRS"
     MARGGSITAE YGLEVLNTVI YLPRGEIFPI TSSATLCNGF SRHRDGSLQP PSHVGAGAVW        60
     RS                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page