(data stored in ACNUC7421 zone)

EMBL: BA000030.PE504

BA000030.PE504       Location/Qualifiers
FT   CDS             complement(643080..643727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_499"
FT                   /old_locus_tag="SAV_499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_499"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68209"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QK7"
FT                   /protein_id="BAC68209.1"
FT                   /translation="MSSFNTHQRRVYDEDLPTRARHTNLRSCLVHFAPYGFRATYHHLC
FT                   LSAGIPKDLEKDPSSLIRAVEELHHARQLWLADERAYANRRRADKARGFRQVKRDESWR
FT                   GWQREWGNIAYCPEPTIHPDEPLPAVVERVLRSSVPPDEAPALTCRVCGNRDNTSVWYD
FT                   GAYRIHQLCRECGVSLAVQRAKAPDPRLAADHARKWKEIWRLRNESPRSYPS"
     MSSFNTHQRR VYDEDLPTRA RHTNLRSCLV HFAPYGFRAT YHHLCLSAGI PKDLEKDPSS        60
     LIRAVEELHH ARQLWLADER AYANRRRADK ARGFRQVKRD ESWRGWQREW GNIAYCPEPT       120
     IHPDEPLPAV VERVLRSSVP PDEAPALTCR VCGNRDNTSV WYDGAYRIHQ LCRECGVSLA       180
     VQRAKAPDPR LAADHARKWK EIWRLRNESP RSYPS                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page