(data stored in ACNUC7421 zone)

EMBL: BA000030.PE512

BA000030.PE512       Location/Qualifiers
FT   CDS             650027..650887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_506"
FT                   /old_locus_tag="SAV_506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_506"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68216"
FT                   /db_xref="GOA:Q82QK0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QK0"
FT                   /protein_id="BAC68216.1"
FT                   /translation="METASLRAAPPPRFHPMASSAGPEDRDTEARSRPATRPLLLRIVT
FT                   VVGSSASFYLLLSVVPAYAQSAPGGGSDKAGLVTGALMLATVAGELTAPWLAARCGFRV
FT                   MLGAGLLLLGAPALALTVSQSMPCIVAVCLVRGLGFAFTLVAGGALTASLIPPELRGEG
FT                   LALIGVMAGVPSLVGLPLGAWLALHTEYGPVCSVAALIALVSIAAVPGLPGREATSAGS
FT                   RYLVAGRVNSLAGVDFAGHTEQSNGLRAVILAKVRAWSTAVTRRRRPGGVVSTPCTNGL
FT                   LQPPV"
     METASLRAAP PPRFHPMASS AGPEDRDTEA RSRPATRPLL LRIVTVVGSS ASFYLLLSVV        60
     PAYAQSAPGG GSDKAGLVTG ALMLATVAGE LTAPWLAARC GFRVMLGAGL LLLGAPALAL       120
     TVSQSMPCIV AVCLVRGLGF AFTLVAGGAL TASLIPPELR GEGLALIGVM AGVPSLVGLP       180
     LGAWLALHTE YGPVCSVAAL IALVSIAAVP GLPGREATSA GSRYLVAGRV NSLAGVDFAG       240
     HTEQSNGLRA VILAKVRAWS TAVTRRRRPG GVVSTPCTNG LLQPPV                      286
//

If you have problems or comments...

PBIL Back to PBIL home page