(data stored in ACNUC7421 zone)

EMBL: BA000030.PE52

BA000030.PE52        Location/Qualifiers
FT   CDS             complement(62965..63342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_52"
FT                   /old_locus_tag="SAV_52"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_52"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67761"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RU1"
FT                   /protein_id="BAC67761.1"
FT                   /translation="MHPIGGAGNAGVNDCPLYSVPVRIHSVTDSDARPEKTGEVVNKIK
FT                   KAAAVAVMVGGMALGGGAAHAAGGHGLDDPADIIIGNLQAVNCDQDFAGGAAFAPVQGI
FT                   STEGNTQNIGSFCTVVGPVYD"
     MHPIGGAGNA GVNDCPLYSV PVRIHSVTDS DARPEKTGEV VNKIKKAAAV AVMVGGMALG        60
     GGAAHAAGGH GLDDPADIII GNLQAVNCDQ DFAGGAAFAP VQGISTEGNT QNIGSFCTVV       120
     GPVYD                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page