(data stored in ACNUC7421 zone)

EMBL: BA000030.PE521

BA000030.PE521       Location/Qualifiers
FT   CDS             complement(659554..660030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_515"
FT                   /old_locus_tag="SAV_515"
FT                   /product="putative oxidoreductase with iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_515"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68225"
FT                   /db_xref="GOA:Q82QJ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QJ1"
FT                   /protein_id="BAC68225.1"
FT                   /translation="MPMPSYSFVLNGERVTVEAPADMPLLWVLRDLLNVTGPKYGCGVG
FT                   VCRACTSHLDGGEIQPCVVPVADCADREVTTIEGLADGNRLHPVQQAWLDCDVAQCGFC
FT                   QPGQIMAAVALLKRTPRPSDADIDAIENVCRCGTYFRIREAIKKASVKFPRSGP"
     MPMPSYSFVL NGERVTVEAP ADMPLLWVLR DLLNVTGPKY GCGVGVCRAC TSHLDGGEIQ        60
     PCVVPVADCA DREVTTIEGL ADGNRLHPVQ QAWLDCDVAQ CGFCQPGQIM AAVALLKRTP       120
     RPSDADIDAI ENVCRCGTYF RIREAIKKAS VKFPRSGP                               158
//

If you have problems or comments...

PBIL Back to PBIL home page