(data stored in ACNUC7421 zone)

EMBL: BA000030.PE523

BA000030.PE523       Location/Qualifiers
FT   CDS             complement(662516..663070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_517"
FT                   /old_locus_tag="SAV_517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_517"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68227"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QI9"
FT                   /protein_id="BAC68227.1"
FT                   /translation="MQTLAAARRAAVRPPARAHLRRAEGRRGQRQQGRPPPAVTAEKAD
FT                   AVRTAYLDGQSIAALAREHGVSRGAIRTAVADLMPEHTTGPEDVPAPELPVLLDMPGKV
FT                   ADFLREADLPDDQRSALAGGVTVRRGQGYTLRVNAAPSIHRELLARSQPLDGAQAVPAQ
FT                   RKARREYENRVNALIAVGERS"
     MQTLAAARRA AVRPPARAHL RRAEGRRGQR QQGRPPPAVT AEKADAVRTA YLDGQSIAAL        60
     AREHGVSRGA IRTAVADLMP EHTTGPEDVP APELPVLLDM PGKVADFLRE ADLPDDQRSA       120
     LAGGVTVRRG QGYTLRVNAA PSIHRELLAR SQPLDGAQAV PAQRKARREY ENRVNALIAV       180
     GERS                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page