(data stored in ACNUC7421 zone)

EMBL: BA000030.PE534

BA000030.PE534       Location/Qualifiers
FT   CDS             672570..673388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_528"
FT                   /old_locus_tag="SAV_528"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_528"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68238"
FT                   /db_xref="GOA:Q82QH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QH8"
FT                   /protein_id="BAC68238.1"
FT                   /translation="MSVEHASMRIIDGYARGDTDIAADEVWALEAHLEACGVCRDRLSA
FT                   AVTAEAPAVAALVGTVWSGLEPQLAATATMPRQRRWSARLSRWMTPTMMPWLAMVVSVT
FT                   LLALLLDLVDTGFGEVSLVLLLAPILPVLGVAASWSRGLDPAYELTASAPRAGLYLVLR
FT                   RTASVLAVVVPVLLVAGWVTGVTAAQWLLPCLAFTSTTLALGGVVGVTRAAVSLAAVWA
FT                   AAVVAPTLATSRTTFALQTGSLPVWGLVLALGTAVVIARRGAYSVLGAHR"
     MSVEHASMRI IDGYARGDTD IAADEVWALE AHLEACGVCR DRLSAAVTAE APAVAALVGT        60
     VWSGLEPQLA ATATMPRQRR WSARLSRWMT PTMMPWLAMV VSVTLLALLL DLVDTGFGEV       120
     SLVLLLAPIL PVLGVAASWS RGLDPAYELT ASAPRAGLYL VLRRTASVLA VVVPVLLVAG       180
     WVTGVTAAQW LLPCLAFTST TLALGGVVGV TRAAVSLAAV WAAAVVAPTL ATSRTTFALQ       240
     TGSLPVWGLV LALGTAVVIA RRGAYSVLGA HR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page