(data stored in ACNUC7421 zone)

EMBL: BA000030.PE535

BA000030.PE535       Location/Qualifiers
FT   CDS             673385..674218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_529"
FT                   /old_locus_tag="SAV_529"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_529"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68239"
FT                   /db_xref="GOA:Q82QH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QH7"
FT                   /protein_id="BAC68239.1"
FT                   /translation="MTIGKEHHMMSAVSAAGIAPTAYAWQIQATGLKVRVGRKRMAVNG
FT                   VDLSLGTGVHGLLGPNGAGKTTLIRTLATVLRPTEGTLEMLGESAGGMGEHRALRRRIG
FT                   YLPQEFGYYKRFTVREFVEYMAWLKEVPKADIPAAVQRAVERVGLADRADERMKALSGG
FT                   MVRRVGIAQAIVNDPTILLLDEPTAGLDPAQRLRFRELLQELGTDTCVLVSTHLVEDVA
FT                   AACTNVVLFAEGRLVFQGPPDELASVGGPEHMGDSPLERGYSAMLLNPEQGRGTW"
     MTIGKEHHMM SAVSAAGIAP TAYAWQIQAT GLKVRVGRKR MAVNGVDLSL GTGVHGLLGP        60
     NGAGKTTLIR TLATVLRPTE GTLEMLGESA GGMGEHRALR RRIGYLPQEF GYYKRFTVRE       120
     FVEYMAWLKE VPKADIPAAV QRAVERVGLA DRADERMKAL SGGMVRRVGI AQAIVNDPTI       180
     LLLDEPTAGL DPAQRLRFRE LLQELGTDTC VLVSTHLVED VAAACTNVVL FAEGRLVFQG       240
     PPDELASVGG PEHMGDSPLE RGYSAMLLNP EQGRGTW                                277
//

If you have problems or comments...

PBIL Back to PBIL home page