(data stored in ACNUC7421 zone)

EMBL: BA000030.PE536

BA000030.PE536       Location/Qualifiers
FT   CDS             674215..675609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_530"
FT                   /old_locus_tag="SAV_530"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_530"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68240"
FT                   /db_xref="GOA:Q82QH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QH6"
FT                   /protein_id="BAC68240.1"
FT                   /translation="MNVRVLRIELKRSVAPWAGAVVLTTALAFLYLIPGSWWTGTTAWT
FT                   AQWTSMALWTRSVLFYLWPLAVGLGALQGLRDHRSKMSELLTSTPRPARHRAATLAGAT
FT                   ALTLASAFALLVLVGAVQVVANTEYTHLGWLPISLVGALSLVAGAVLGMGAGRALPSVL
FT                   TPPALAMGAFVFTVLLQTSLGRTETTTATGLPSTEPNRVSLLSPAVQEVRDALVTLSAS
FT                   VHVGQTIWLLAMAATGFALLVAATPRARLLALTPVLAGAALALLVLPSDPRRMYVVDEA
FT                   AAELVCDGPVCVTKTQQARLADLAGPGKEVLRLLHGALGSQAPVSVRENTAVLPEGSTP
FT                   QWSRTTVLFDFDDDLIAAAKGEELTRALIAKGLVPGCTPVGWSGFGSDEFAQTVAVGWV
FT                   LGDLRPLPGTPASLRREVNAKTRPVWKKLKALPRAEQLSRINAMRTAALSCKGDAFDAL
FT                   NGGASR"
     MNVRVLRIEL KRSVAPWAGA VVLTTALAFL YLIPGSWWTG TTAWTAQWTS MALWTRSVLF        60
     YLWPLAVGLG ALQGLRDHRS KMSELLTSTP RPARHRAATL AGATALTLAS AFALLVLVGA       120
     VQVVANTEYT HLGWLPISLV GALSLVAGAV LGMGAGRALP SVLTPPALAM GAFVFTVLLQ       180
     TSLGRTETTT ATGLPSTEPN RVSLLSPAVQ EVRDALVTLS ASVHVGQTIW LLAMAATGFA       240
     LLVAATPRAR LLALTPVLAG AALALLVLPS DPRRMYVVDE AAAELVCDGP VCVTKTQQAR       300
     LADLAGPGKE VLRLLHGALG SQAPVSVREN TAVLPEGSTP QWSRTTVLFD FDDDLIAAAK       360
     GEELTRALIA KGLVPGCTPV GWSGFGSDEF AQTVAVGWVL GDLRPLPGTP ASLRREVNAK       420
     TRPVWKKLKA LPRAEQLSRI NAMRTAALSC KGDAFDALNG GASR                        464
//

If you have problems or comments...

PBIL Back to PBIL home page