(data stored in ACNUC7421 zone)

EMBL: BA000030.PE539

BA000030.PE539       Location/Qualifiers
FT   CDS             676902..677138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_533"
FT                   /old_locus_tag="SAV_533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_533"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68243"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QH3"
FT                   /protein_id="BAC68243.1"
FT                   /translation="MAPRSSKSWSTTAAASPARSPQPSPHHRCSVGVHGAEWTWPSLVM
FT                   ILSGHMEATTPLGARAGVGLFEVVMYSLAVRPG"
     MAPRSSKSWS TTAAASPARS PQPSPHHRCS VGVHGAEWTW PSLVMILSGH MEATTPLGAR        60
     AGVGLFEVVM YSLAVRPG                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page