(data stored in ACNUC7421 zone)

EMBL: BA000030.PE545

BA000030.PE545       Location/Qualifiers
FT   CDS             complement(681371..682687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_539"
FT                   /old_locus_tag="SAV_539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_539"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68249"
FT                   /db_xref="GOA:Q82QG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QG7"
FT                   /protein_id="BAC68249.1"
FT                   /translation="MTNSLGPDSGSRSGSHVMVRRGLTKSKCAQAEMVWVALVLLLTAL
FT                   PVGWCGLKDFKDALTFPGCVTGAALMVAALIMLVGVAAVVDCWIRGPISNFGVVALIST
FT                   GVALLTNVLLAFQTWNDGERVVYKVLSIVLSVGSLLAVIQVWRRLDEIPTPKRVAAALI
FT                   VSTIVAVANFSYQYLFQPHRREVAPLVQLNVGKAVLSADRKAFSVPVDIKLVNHSDVSF
FT                   YVLGAEFHAMGEDVTVSPTDLDRSKWREGAEQWARYREKHPLTRREVYQPGKLVAAQQW
FT                   IPAGHWVEAKDEALTRTVVQLPIDTHFDKLTFYATLSLARKDRLVMGNFGRPGYSWRGV
FT                   ELPHWVKAGQEDNDTIIQTADMQENNAIDHYTRESRRVTTYWRFGLHGVDVAPVIVPVG
FT                   EEGRTFSEQTNREVRNRYGLIDVLAGPVEQTLDEIKSRR"
     MTNSLGPDSG SRSGSHVMVR RGLTKSKCAQ AEMVWVALVL LLTALPVGWC GLKDFKDALT        60
     FPGCVTGAAL MVAALIMLVG VAAVVDCWIR GPISNFGVVA LISTGVALLT NVLLAFQTWN       120
     DGERVVYKVL SIVLSVGSLL AVIQVWRRLD EIPTPKRVAA ALIVSTIVAV ANFSYQYLFQ       180
     PHRREVAPLV QLNVGKAVLS ADRKAFSVPV DIKLVNHSDV SFYVLGAEFH AMGEDVTVSP       240
     TDLDRSKWRE GAEQWARYRE KHPLTRREVY QPGKLVAAQQ WIPAGHWVEA KDEALTRTVV       300
     QLPIDTHFDK LTFYATLSLA RKDRLVMGNF GRPGYSWRGV ELPHWVKAGQ EDNDTIIQTA       360
     DMQENNAIDH YTRESRRVTT YWRFGLHGVD VAPVIVPVGE EGRTFSEQTN REVRNRYGLI       420
     DVLAGPVEQT LDEIKSRR                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page