(data stored in ACNUC7421 zone)

EMBL: BA000030.PE548

BA000030.PE548       Location/Qualifiers
FT   CDS             685826..686794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_542"
FT                   /old_locus_tag="SAV_542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_542"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68252"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QG4"
FT                   /protein_id="BAC68252.1"
FT                   /translation="MGPWRDPTSAQALAVSLRPSGRSHRPTQVRRPPMAAGASNSTANA
FT                   DWGKANFNDIYNCPDPRPYFATLRSLEYQIPHHGQAVFRALTYALRWLHPDRTPLNVVD
FT                   LCCSYGINTALLNCRVTLSDLSTRYTSHHLSALPTRQLAAEDRTFFAARRRPEAATATG
FT                   IDSAALAVGYARAVGLLDHAFAENLEVTEPSPALRRTLAGTDLITVTGGVGYVFTRTFT
FT                   RLLDCMPTPPWVAAFVLRTVPYQPIADLLARSGLVTEKLSARTFRQRRFADSAERYAAF
FT                   HALAVNGLHTADKEADGFYHTDLYVSRPAPDIAALPLARLL"
     MGPWRDPTSA QALAVSLRPS GRSHRPTQVR RPPMAAGASN STANADWGKA NFNDIYNCPD        60
     PRPYFATLRS LEYQIPHHGQ AVFRALTYAL RWLHPDRTPL NVVDLCCSYG INTALLNCRV       120
     TLSDLSTRYT SHHLSALPTR QLAAEDRTFF AARRRPEAAT ATGIDSAALA VGYARAVGLL       180
     DHAFAENLEV TEPSPALRRT LAGTDLITVT GGVGYVFTRT FTRLLDCMPT PPWVAAFVLR       240
     TVPYQPIADL LARSGLVTEK LSARTFRQRR FADSAERYAA FHALAVNGLH TADKEADGFY       300
     HTDLYVSRPA PDIAALPLAR LL                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page