(data stored in ACNUC7421 zone)

EMBL: BA000030.PE554

BA000030.PE554       Location/Qualifiers
FT   CDS             complement(693265..694434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_548"
FT                   /old_locus_tag="SAV_548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_548"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68258"
FT                   /db_xref="InterPro:IPR025566"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QF9"
FT                   /protein_id="BAC68258.1"
FT                   /translation="MADHFSGPRAIADPASDIADVYAFPSPERPGNLVLVLNTFPASAP
FT                   TALFSDAITYRFRVRPVTPGSESADAAFNVGEDEYVFDFTFDAPQKVDGTDTLLQMGTC
FT                   HAPSGRKIAFQVGNEVPTEAEELKIFAGSRLDPFFIDFVGVMVTEATGKLGFRSDASNV
FT                   LEGLNALSIVLEVDAAVLGPAADSLVAVVGETVTSGGRPVRLERMGRPEIKNVIMSPKK
FT                   FDTVNSDLEIRDLFNEEDAFSVRPDYASTYRARLNANLAFYDGLDGKTAWPLDEQGAHP
FT                   LTELLLADFLVVDLSKPFSEDGCFEIETALLAGRPHTTCGGRSLNDDIVDTLFTLLVGG
FT                   IDGERISDGVDQPTQPATHSFPYLNAPNPTPPDLGARLAAQMPPREEAA"
     MADHFSGPRA IADPASDIAD VYAFPSPERP GNLVLVLNTF PASAPTALFS DAITYRFRVR        60
     PVTPGSESAD AAFNVGEDEY VFDFTFDAPQ KVDGTDTLLQ MGTCHAPSGR KIAFQVGNEV       120
     PTEAEELKIF AGSRLDPFFI DFVGVMVTEA TGKLGFRSDA SNVLEGLNAL SIVLEVDAAV       180
     LGPAADSLVA VVGETVTSGG RPVRLERMGR PEIKNVIMSP KKFDTVNSDL EIRDLFNEED       240
     AFSVRPDYAS TYRARLNANL AFYDGLDGKT AWPLDEQGAH PLTELLLADF LVVDLSKPFS       300
     EDGCFEIETA LLAGRPHTTC GGRSLNDDIV DTLFTLLVGG IDGERISDGV DQPTQPATHS       360
     FPYLNAPNPT PPDLGARLAA QMPPREEAA                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page