(data stored in ACNUC7421 zone)

EMBL: BA000030.PE559

BA000030.PE559       Location/Qualifiers
FT   CDS             complement(700072..700701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_553"
FT                   /old_locus_tag="SAV_553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_553"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68263"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZP8"
FT                   /protein_id="BAC68263.1"
FT                   /translation="MNATVTKKAGKGATDGVVSEMATYFHIKPGHEQECAAACQRMVEA
FT                   LKQAPMAATIKTGLRDTRHVIFNNGTELLWATTFETEWEPYIDDAFLTVGFEHFVDWMQ
FT                   HTTEWDTKIAPWIEKSGGLESLTGDKTREGFDEHIIANMAGMRWILQDGQQKATAYWNP
FT                   VSSLTMSEITKAERINAAFQEVLDDPAAEEALQHPALKPLLAQAAS"
     MNATVTKKAG KGATDGVVSE MATYFHIKPG HEQECAAACQ RMVEALKQAP MAATIKTGLR        60
     DTRHVIFNNG TELLWATTFE TEWEPYIDDA FLTVGFEHFV DWMQHTTEWD TKIAPWIEKS       120
     GGLESLTGDK TREGFDEHII ANMAGMRWIL QDGQQKATAY WNPVSSLTMS EITKAERINA       180
     AFQEVLDDPA AEEALQHPAL KPLLAQAAS                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page