(data stored in ACNUC7421 zone)

EMBL: BA000030.PE565

BA000030.PE565       Location/Qualifiers
FT   CDS             708335..708796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_559"
FT                   /old_locus_tag="SAV_559"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_559"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68269"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QF0"
FT                   /protein_id="BAC68269.1"
FT                   /translation="MKLTKRISLAAASAAVAGGALLGAGGTASAAVPESAHIERPAVSI
FT                   KADDYREDRGVNYRHNSEEDYRRDGYRARQHSDHFSDSDRYDRRGHSYYWDDEDRCWKH
FT                   DSNYRYDWDRSDRRDSNRDDRDWNRYDHDWNRYDHDSNRSNHDRVLDNR"
     MKLTKRISLA AASAAVAGGA LLGAGGTASA AVPESAHIER PAVSIKADDY REDRGVNYRH        60
     NSEEDYRRDG YRARQHSDHF SDSDRYDRRG HSYYWDDEDR CWKHDSNYRY DWDRSDRRDS       120
     NRDDRDWNRY DHDWNRYDHD SNRSNHDRVL DNR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page