(data stored in ACNUC7421 zone)

EMBL: BA000030.PE573

BA000030.PE573       Location/Qualifiers
FT   CDS             717968..719413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_567"
FT                   /old_locus_tag="SAV_567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_567"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68277"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QE2"
FT                   /protein_id="BAC68277.1"
FT                   /translation="MDLTADSLLSRAAHELSPRADEVIHDVEQCLRREIPELWDEPDIA
FT                   QMTRENVAEHVVALLFGIEHSIEPRRIDQPAADAERARRLAQRGKPVTAMLRAFPLAHA
FT                   RVLDRLLEELPRLTSDAESINAAARKLIALSIAYMARTSETGVLAFQEERDRQLQWRLS
FT                   VVNEASVRVGTTLDIARTAQELVDLATEHFADAVTVDLLDMPSGDEPPAKGTLVVRRIA
FT                   QQSVMDGYPETTSLEAIYGELPVSPQQVHRYPDGSPPARALATGRPSRHHLGPSASMLL
FT                   VPLCARGTTLGVVQFFRHHRPDAYGDEDLLLAQEVAARAAVAIDNARRYTHARATALTL
FT                   QRSLLPRRHPRSPPWRSPAATCLLPPSSAWAATGTTSSRCPVPGSHSWWATWSATASTP
FT                   PPPWAGCGPPCAPSPTSTCRPTNSSPTWTTSSSACPPKSLPKPLPKRTPNPQGTSGPPA
FT                   CTPYTIPSPAAAPSPARATCCPS"
     MDLTADSLLS RAAHELSPRA DEVIHDVEQC LRREIPELWD EPDIAQMTRE NVAEHVVALL        60
     FGIEHSIEPR RIDQPAADAE RARRLAQRGK PVTAMLRAFP LAHARVLDRL LEELPRLTSD       120
     AESINAAARK LIALSIAYMA RTSETGVLAF QEERDRQLQW RLSVVNEASV RVGTTLDIAR       180
     TAQELVDLAT EHFADAVTVD LLDMPSGDEP PAKGTLVVRR IAQQSVMDGY PETTSLEAIY       240
     GELPVSPQQV HRYPDGSPPA RALATGRPSR HHLGPSASML LVPLCARGTT LGVVQFFRHH       300
     RPDAYGDEDL LLAQEVAARA AVAIDNARRY THARATALTL QRSLLPRRHP RSPPWRSPAA       360
     TCLLPPSSAW AATGTTSSRC PVPGSHSWWA TWSATASTPP PPWAGCGPPC APSPTSTCRP       420
     TNSSPTWTTS SSACPPKSLP KPLPKRTPNP QGTSGPPACT PYTIPSPAAA PSPARATCCP       480
     S                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page