(data stored in ACNUC7421 zone)

EMBL: BA000030.PE585

BA000030.PE585       Location/Qualifiers
FT   CDS             complement(734105..734434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_579"
FT                   /old_locus_tag="SAV_579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_579"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68289"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QD1"
FT                   /protein_id="BAC68289.1"
FT                   /translation="MSQYQLRVYTLRSPEALVAYENIWSQHIPGMAKHRITTHGVWTVP
FT                   AAPGSEEPQLYALVSYRDADDVQERLEAYLSSPEFRADMEGFDISQIVGVAESVLTPTA
FT                   DSPLR"
     MSQYQLRVYT LRSPEALVAY ENIWSQHIPG MAKHRITTHG VWTVPAAPGS EEPQLYALVS        60
     YRDADDVQER LEAYLSSPEF RADMEGFDIS QIVGVAESVL TPTADSPLR                   109
//

If you have problems or comments...

PBIL Back to PBIL home page