(data stored in ACNUC7421 zone)

EMBL: BA000030.PE587

BA000030.PE587       Location/Qualifiers
FT   CDS             complement(734950..735294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_581"
FT                   /old_locus_tag="SAV_581"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_581"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68291"
FT                   /db_xref="GOA:Q82QC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QC9"
FT                   /protein_id="BAC68291.1"
FT                   /translation="MEGFAQAAPDAAHRLHAADGADRTHQEGKTMKRLTRRVAVTAFCV
FT                   AVAGVAALGAGGTASAATSASVHGQRPAVSVDAGDYRWDHGVGYLLELGYSWDEIRGWH
FT                   HDGRDEISGC"
     MEGFAQAAPD AAHRLHAADG ADRTHQEGKT MKRLTRRVAV TAFCVAVAGV AALGAGGTAS        60
     AATSASVHGQ RPAVSVDAGD YRWDHGVGYL LELGYSWDEI RGWHHDGRDE ISGC             114
//

If you have problems or comments...

PBIL Back to PBIL home page