(data stored in ACNUC7421 zone)

EMBL: BA000030.PE60

BA000030.PE60        Location/Qualifiers
FT   CDS             complement(70102..70617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_60"
FT                   /old_locus_tag="SAV_60"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_60"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67769"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RT3"
FT                   /protein_id="BAC67769.1"
FT                   /translation="MGSTDDARLQAVLSALWSAANVQGCFGQSDREPEEQDAVPCTVAS
FT                   LAEFGHLYGRVRLPTGQLVVCGCVAVRGGDESSDWLDLYVPVGALDHAGVAYWDGRPFF
FT                   RSAATDDWLAAVGAEAFRSASFSLGVIGFEASGCTSASTMAGRLPEERDIGYLLPRGEV
FT                   LHYGAANT"
     MGSTDDARLQ AVLSALWSAA NVQGCFGQSD REPEEQDAVP CTVASLAEFG HLYGRVRLPT        60
     GQLVVCGCVA VRGGDESSDW LDLYVPVGAL DHAGVAYWDG RPFFRSAATD DWLAAVGAEA       120
     FRSASFSLGV IGFEASGCTS ASTMAGRLPE ERDIGYLLPR GEVLHYGAAN T                171
//

If you have problems or comments...

PBIL Back to PBIL home page