(data stored in ACNUC7421 zone)

EMBL: BA000030.PE619

BA000030.PE619       Location/Qualifiers
FT   CDS             767298..767819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_613"
FT                   /old_locus_tag="SAV_613"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_613"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68323"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QA7"
FT                   /protein_id="BAC68323.1"
FT                   /translation="MEPRSLMRVMRPTRNTWFVNALRTVAPPLGASCGALALMVAYTAT
FT                   GAAGDPPPRITVVDAHIVAVSAGSGSTAAYFEIRNTGPSKDTLLYADSPDLGVSLLRRT
FT                   VRRTGTGRTEPVWAVDVPAGGTVRMAPGGLGVVILDPPVLKAGQKVPYLLWFRQSGKVA
FT                   VRATVTAGVR"
     MEPRSLMRVM RPTRNTWFVN ALRTVAPPLG ASCGALALMV AYTATGAAGD PPPRITVVDA        60
     HIVAVSAGSG STAAYFEIRN TGPSKDTLLY ADSPDLGVSL LRRTVRRTGT GRTEPVWAVD       120
     VPAGGTVRMA PGGLGVVILD PPVLKAGQKV PYLLWFRQSG KVAVRATVTA GVR              173
//

If you have problems or comments...

PBIL Back to PBIL home page