(data stored in ACNUC7421 zone)

EMBL: BA000030.PE621

BA000030.PE621       Location/Qualifiers
FT   CDS             complement(768752..769429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_615"
FT                   /old_locus_tag="SAV_615"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_615"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68325"
FT                   /db_xref="GOA:Q82QA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QA5"
FT                   /protein_id="BAC68325.1"
FT                   /translation="MTAGWCARAIRAAVFAAVCVLLAALGHVLMSGSTVPWWTMTAGFA
FT                   ATTGVGWCLAGRERGLALVVPAAVVAQGALHSAFSLAQSAASDTGAGGVAHGMRGMSMS
FT                   ATSMDAMDMRSAPMGCSEQPGQLGHLVHDMGGGSSFGMLAAHALAAVLSGLWLAYGERA
FT                   AFRVLRAVAGWLAAPLRLSLALPAPPCRPRLVPTRERSERVPRLSLAHTIISRGPPAGM
FT                   AVA"
     MTAGWCARAI RAAVFAAVCV LLAALGHVLM SGSTVPWWTM TAGFAATTGV GWCLAGRERG        60
     LALVVPAAVV AQGALHSAFS LAQSAASDTG AGGVAHGMRG MSMSATSMDA MDMRSAPMGC       120
     SEQPGQLGHL VHDMGGGSSF GMLAAHALAA VLSGLWLAYG ERAAFRVLRA VAGWLAAPLR       180
     LSLALPAPPC RPRLVPTRER SERVPRLSLA HTIISRGPPA GMAVA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page