(data stored in ACNUC7421 zone)

EMBL: BA000030.PE628

BA000030.PE628       Location/Qualifiers
FT   CDS             775498..775956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_622"
FT                   /old_locus_tag="SAV_622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_622"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68332"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q98"
FT                   /protein_id="BAC68332.1"
FT                   /translation="MAEHIAGLCTTRHTPYAPRALLRRPLGCPKPEKDLGGRPMTENEN
FT                   ERATELGDAIEAVRQGLLKAAAQGSDDLRFLVKETELEFIVELRKTGSTGAGVKAWVLS
FT                   GDGRLERSAGQTNRLTVRLGILAPESHPIDETHFGDKKDKGHPGPRQM"
     MAEHIAGLCT TRHTPYAPRA LLRRPLGCPK PEKDLGGRPM TENENERATE LGDAIEAVRQ        60
     GLLKAAAQGS DDLRFLVKET ELEFIVELRK TGSTGAGVKA WVLSGDGRLE RSAGQTNRLT       120
     VRLGILAPES HPIDETHFGD KKDKGHPGPR QM                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page