(data stored in ACNUC7421 zone)

EMBL: BA000030.PE630

BA000030.PE630       Location/Qualifiers
FT   CDS             complement(776473..777039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_624"
FT                   /old_locus_tag="SAV_624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_624"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68334"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q96"
FT                   /protein_id="BAC68334.1"
FT                   /translation="MPASPAASAQAIALLRELGATEIAHPGGTLLAHLQRVQEQLAVWE
FT                   ARTALQLAGLCHAFYGTDGFPAALLSLDRRDELAAAIGVEAEGIVYLYASCDRKATYPT
FT                   LADADASFRDRFTGRARIPEPQLRRDFAELSAANELDLARIDPAFREKWGSELLALCTR
FT                   FRPLLSQPAWSACHVVLAPDPPAQD"
     MPASPAASAQ AIALLRELGA TEIAHPGGTL LAHLQRVQEQ LAVWEARTAL QLAGLCHAFY        60
     GTDGFPAALL SLDRRDELAA AIGVEAEGIV YLYASCDRKA TYPTLADADA SFRDRFTGRA       120
     RIPEPQLRRD FAELSAANEL DLARIDPAFR EKWGSELLAL CTRFRPLLSQ PAWSACHVVL       180
     APDPPAQD                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page