(data stored in ACNUC7421 zone)

EMBL: BA000030.PE635

BA000030.PE635       Location/Qualifiers
FT   CDS             782844..783239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_629"
FT                   /old_locus_tag="SAV_629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_629"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68339"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q91"
FT                   /protein_id="BAC68339.1"
FT                   /translation="MTTLPTTSAAAAERLGPARALTRAVAAYSALWRPFGTNDGSGLVR
FT                   EQVPVAADDKPYSYEWPYSQVHIAALDLTAVDAAYESEPAERTKAQEHFWHVGKGTTGC
FT                   PGYASYPVVACGEGGEGGAAPRRRPAP"
     MTTLPTTSAA AAERLGPARA LTRAVAAYSA LWRPFGTNDG SGLVREQVPV AADDKPYSYE        60
     WPYSQVHIAA LDLTAVDAAY ESEPAERTKA QEHFWHVGKG TTGCPGYASY PVVACGEGGE       120
     GGAAPRRRPA P                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page