(data stored in ACNUC7421 zone)

EMBL: BA000030.PE638

BA000030.PE638       Location/Qualifiers
FT   CDS             785356..785871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_631"
FT                   /old_locus_tag="SAV_631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_631"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68342"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q88"
FT                   /protein_id="BAC68342.1"
FT                   /translation="MRSVTLKDLRDGTHRTLAARYVLDATETGELLHLAGVEHANGAES
FT                   RATACPLADLALGRIVFPTAPLPPGMTDPRAAVDGDAGTAWSPGPDGRMVVDLDAEQHI
FT                   TEIRTQWRGGHAPASQVEFSRDGRTYGGAAQLSARGVLRTDSTPRDVALRVITSSAGPT
FT                   SLIALTIA"
     MRSVTLKDLR DGTHRTLAAR YVLDATETGE LLHLAGVEHA NGAESRATAC PLADLALGRI        60
     VFPTAPLPPG MTDPRAAVDG DAGTAWSPGP DGRMVVDLDA EQHITEIRTQ WRGGHAPASQ       120
     VEFSRDGRTY GGAAQLSARG VLRTDSTPRD VALRVITSSA GPTSLIALTI A                171
//

If you have problems or comments...

PBIL Back to PBIL home page