(data stored in ACNUC7421 zone)

EMBL: BA000030.PE644

BA000030.PE644       Location/Qualifiers
FT   CDS             793192..794145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_638"
FT                   /old_locus_tag="SAV_638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_638"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68348"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q82"
FT                   /protein_id="BAC68348.1"
FT                   /translation="MQEVTRHEVSGQHIAHALDDISRRTRRRWHGMRYDDPSLEKLQEM
FT                   RDELLDHIAARTVEDPALDESSRAALRTAAECSLGVLSVGCFPDGDQEIVFPLIGERLG
FT                   SEDIAFGDVVEQAPTAGTWVDTFAICLVSGLVWDWQRVIGLLLREDYAPAIRDGVPYSK
FT                   LNSASDPADLAAMDALCGYLTQAQGHLPRDWPTVPLCKPDTDERAEAARKLDAAGPLTS
FT                   DQRLLRVLLEDDQHAFEQTLVAHLSEHRESVGSDPAPRTLLPVGALALTALAVQVHGWE
FT                   LDVRSGYLPHGMLGSPDTLRRAADAGGNDLGHWTAK"
     MQEVTRHEVS GQHIAHALDD ISRRTRRRWH GMRYDDPSLE KLQEMRDELL DHIAARTVED        60
     PALDESSRAA LRTAAECSLG VLSVGCFPDG DQEIVFPLIG ERLGSEDIAF GDVVEQAPTA       120
     GTWVDTFAIC LVSGLVWDWQ RVIGLLLRED YAPAIRDGVP YSKLNSASDP ADLAAMDALC       180
     GYLTQAQGHL PRDWPTVPLC KPDTDERAEA ARKLDAAGPL TSDQRLLRVL LEDDQHAFEQ       240
     TLVAHLSEHR ESVGSDPAPR TLLPVGALAL TALAVQVHGW ELDVRSGYLP HGMLGSPDTL       300
     RRAADAGGND LGHWTAK                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page