(data stored in ACNUC7421 zone)

EMBL: BA000030.PE65

BA000030.PE65        Location/Qualifiers
FT   CDS             74098..74520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_65"
FT                   /old_locus_tag="SAV_65"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_65"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67774"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RS8"
FT                   /protein_id="BAC67774.1"
FT                   /translation="MTDDAYLFLLDDPAVPLGVPPSVAGELSCMDTPAVRAWLDAQGVT
FT                   TTSPALRILPPEQTAAIPEQAERLPVPLSEAELSRLRHHNAPEAVARLEEELLAYRDCT
FT                   DGRDTLLRRALAAGIPLARIVELTGEEPAAVAASSG"
     MTDDAYLFLL DDPAVPLGVP PSVAGELSCM DTPAVRAWLD AQGVTTTSPA LRILPPEQTA        60
     AIPEQAERLP VPLSEAELSR LRHHNAPEAV ARLEEELLAY RDCTDGRDTL LRRALAAGIP       120
     LARIVELTGE EPAAVAASSG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page