(data stored in ACNUC7421 zone)

EMBL: BA000030.PE652

BA000030.PE652       Location/Qualifiers
FT   CDS             complement(803533..804099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_646"
FT                   /old_locus_tag="SAV_646"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_646"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68356"
FT                   /db_xref="GOA:Q82Q75"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q75"
FT                   /protein_id="BAC68356.1"
FT                   /translation="MGAEHHRITALLTGLQTLARGDAHALPDRVPVDLGALLHEAVSHA
FT                   ARRHPTTYRLNGSTPATLTGWPVGLRLAVDNLLDNAALHGRPDGTVDIQLTHEAGTVRI
FT                   TVSDDGPGIPPDQRHAMKERFTRGPRTRAPGSGLGLALVEQQAHLHHGTLHLGQSPAGG
FT                   LQATLSLPAADEPGPPGEPMADASS"
     MGAEHHRITA LLTGLQTLAR GDAHALPDRV PVDLGALLHE AVSHAARRHP TTYRLNGSTP        60
     ATLTGWPVGL RLAVDNLLDN AALHGRPDGT VDIQLTHEAG TVRITVSDDG PGIPPDQRHA       120
     MKERFTRGPR TRAPGSGLGL ALVEQQAHLH HGTLHLGQSP AGGLQATLSL PAADEPGPPG       180
     EPMADASS                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page