(data stored in ACNUC7421 zone)

EMBL: BA000030.PE667

BA000030.PE667       Location/Qualifiers
FT   CDS             complement(818939..819619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_661"
FT                   /old_locus_tag="SAV_661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_661"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68371"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q60"
FT                   /protein_id="BAC68371.1"
FT                   /translation="MLLPRQTVQCALRDQSACGLASHGATFWPTTKQHESTTSRASGST
FT                   GQLRHNVTTAPGKSRCCLVGATAGLRASPPSGCRSRCRTSAHHFVDSYADMHDLAEDLP
FT                   VPDGVPEAAATVLHTARELLRHSYVCYEFSAVAVMHFLIAVEIVLRDRIPDAGKKPLRK
FT                   LIEQGAGAGVLTARQAEYLDYGRKIRNGMAHGQTTHTAMPPAVAVLMVTTSFAIVTEPC
FT                   APAL"
     MLLPRQTVQC ALRDQSACGL ASHGATFWPT TKQHESTTSR ASGSTGQLRH NVTTAPGKSR        60
     CCLVGATAGL RASPPSGCRS RCRTSAHHFV DSYADMHDLA EDLPVPDGVP EAAATVLHTA       120
     RELLRHSYVC YEFSAVAVMH FLIAVEIVLR DRIPDAGKKP LRKLIEQGAG AGVLTARQAE       180
     YLDYGRKIRN GMAHGQTTHT AMPPAVAVLM VTTSFAIVTE PCAPAL                      226
//

If you have problems or comments...

PBIL Back to PBIL home page