(data stored in ACNUC7421 zone)

EMBL: BA000030.PE677

BA000030.PE677       Location/Qualifiers
FT   CDS             829572..830048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_671"
FT                   /old_locus_tag="SAV_671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_671"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68381"
FT                   /db_xref="GOA:Q82Q50"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q50"
FT                   /protein_id="BAC68381.1"
FT                   /translation="MAAPVSTPRQVAQRLPAVLCIGGLVQRGEVWWVQFDERRLVVLLS
FT                   GDDASGFQVMQVVAPAGLDISGLGIEVTVGAGEGLPLEGVLRLAFPRPGFTPCTWLTTV
FT                   SRDDLIERAAVLSSRKLSEIDDALRLAEQAQERTPATTAKLSEIRDALRRGELG"
     MAAPVSTPRQ VAQRLPAVLC IGGLVQRGEV WWVQFDERRL VVLLSGDDAS GFQVMQVVAP        60
     AGLDISGLGI EVTVGAGEGL PLEGVLRLAF PRPGFTPCTW LTTVSRDDLI ERAAVLSSRK       120
     LSEIDDALRL AEQAQERTPA TTAKLSEIRD ALRRGELG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page