(data stored in ACNUC7421 zone)

EMBL: BA000030.PE68

BA000030.PE68        Location/Qualifiers
FT   CDS             77069..78430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_68"
FT                   /old_locus_tag="SAV_68"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_68"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67777"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RS5"
FT                   /protein_id="BAC67777.1"
FT                   /translation="MHLASGAPLEPIAGDDTGGTYFLCGATAVLHASSEGDAVLLADSV
FT                   GEALEILVRLPWWCENISAELDEEDLLAEVRAADHAAREEFAPELDAQRAALISGLGLP
FT                   DRPLAELLAMSQSAAGRTEPDHVLLNSRELCAYRLEESFRQPLRDVVLGPGREVLERMR
FT                   RGGLGAREEAAGDPVLRAGVLRAAQYDRRDGDLPLLRLLLEHESAARTERFEERRLAAV
FT                   LVALHGREGDVSLLRSATGGQVTDSAEAVEWARAEEAKRYGRDVAAESEFTWIELARRQ
FT                   GRIERARVALIRMLDDTGPDADRLRELSRALERIGDYAQAARAQFNLLSLQDTAWDRAS
FT                   EAYVLARLERRRGDLVAAGRALERARAAVGAGGTTPGGADCQWHRRGLGRLITEQHLEL
FT                   TLAAAEAGDAELARATMGHGRLLLDTVGKESAKALSRLSTRAKWAVAGLRPPGA"
     MHLASGAPLE PIAGDDTGGT YFLCGATAVL HASSEGDAVL LADSVGEALE ILVRLPWWCE        60
     NISAELDEED LLAEVRAADH AAREEFAPEL DAQRAALISG LGLPDRPLAE LLAMSQSAAG       120
     RTEPDHVLLN SRELCAYRLE ESFRQPLRDV VLGPGREVLE RMRRGGLGAR EEAAGDPVLR       180
     AGVLRAAQYD RRDGDLPLLR LLLEHESAAR TERFEERRLA AVLVALHGRE GDVSLLRSAT       240
     GGQVTDSAEA VEWARAEEAK RYGRDVAAES EFTWIELARR QGRIERARVA LIRMLDDTGP       300
     DADRLRELSR ALERIGDYAQ AARAQFNLLS LQDTAWDRAS EAYVLARLER RRGDLVAAGR       360
     ALERARAAVG AGGTTPGGAD CQWHRRGLGR LITEQHLELT LAAAEAGDAE LARATMGHGR       420
     LLLDTVGKES AKALSRLSTR AKWAVAGLRP PGA                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page