(data stored in ACNUC7421 zone)

EMBL: BA000030.PE685

BA000030.PE685       Location/Qualifiers
FT   CDS             836553..836768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_679"
FT                   /old_locus_tag="SAV_679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_679"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68389"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q42"
FT                   /protein_id="BAC68389.1"
FT                   /translation="MTVSKNINNPVGMGGGQRKKLSRAERQNNGPHRNLDRQGAADQKA
FT                   ELVRKMREKAGAAEGAGQAGDGSAQS"
     MTVSKNINNP VGMGGGQRKK LSRAERQNNG PHRNLDRQGA ADQKAELVRK MREKAGAAEG        60
     AGQAGDGSAQ S                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page