(data stored in ACNUC7421 zone)

EMBL: BA000030.PE686

BA000030.PE686       Location/Qualifiers
FT   CDS             837091..837753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_680"
FT                   /old_locus_tag="SAV_680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_680"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68390"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q41"
FT                   /protein_id="BAC68390.1"
FT                   /translation="MQPPQDPSNVTHVLVAAFPARLAGAVQSVLAVMPDARLAPAESFE
FT                   VVEVQGETVAIPYRIYNEEPETGGSERPLTETQQMILHCLYSRHSDGRVRQRHLEKIMA
FT                   SSEPWVVPFVVQLAGEYVLEILDAIGLGVPGLAAPGSADRRLYGEFIERNPDFFARTER
FT                   RVVSYWSCYYRRKYEVFGTYPGSALMEAFRAAASEHAGVQWPRRTPPPSATCSAGPP"
     MQPPQDPSNV THVLVAAFPA RLAGAVQSVL AVMPDARLAP AESFEVVEVQ GETVAIPYRI        60
     YNEEPETGGS ERPLTETQQM ILHCLYSRHS DGRVRQRHLE KIMASSEPWV VPFVVQLAGE       120
     YVLEILDAIG LGVPGLAAPG SADRRLYGEF IERNPDFFAR TERRVVSYWS CYYRRKYEVF       180
     GTYPGSALME AFRAAASEHA GVQWPRRTPP PSATCSAGPP                             220
//

If you have problems or comments...

PBIL Back to PBIL home page