(data stored in ACNUC7421 zone)

EMBL: BA000030.PE699

BA000030.PE699       Location/Qualifiers
FT   CDS             complement(846848..847663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_693"
FT                   /old_locus_tag="SAV_693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_693"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68403"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q28"
FT                   /protein_id="BAC68403.1"
FT                   /translation="MADVPKIALAAAVLGGYVVGRTKKGRVAFAMATYLAGRRFGLEPQ
FT                   QLLAEGVKRLRELPQFADLNEQLRGEVLEAGRKAMTTAADRKLADLADSLHQRTERMGS
FT                   KGKEEPQDDEEPEEGDEEEEVPEGEEPEEGEGEEAEDEYEEDEEEEPEEEPGEDEEEPE
FT                   GEQEPEEEEEPEEEEEPEEEEEPERPASRRRRAARKPDDDSDGGSRRGRGGARRPERAA
FT                   ARKAPAKKSAPAKKTSAARKSSASPKKSPVKKSAAKKTAAKKASSRRRR"
     MADVPKIALA AAVLGGYVVG RTKKGRVAFA MATYLAGRRF GLEPQQLLAE GVKRLRELPQ        60
     FADLNEQLRG EVLEAGRKAM TTAADRKLAD LADSLHQRTE RMGSKGKEEP QDDEEPEEGD       120
     EEEEVPEGEE PEEGEGEEAE DEYEEDEEEE PEEEPGEDEE EPEGEQEPEE EEEPEEEEEP       180
     EEEEEPERPA SRRRRAARKP DDDSDGGSRR GRGGARRPER AAARKAPAKK SAPAKKTSAA       240
     RKSSASPKKS PVKKSAAKKT AAKKASSRRR R                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page