(data stored in ACNUC7421 zone)

EMBL: BA000030.PE700

BA000030.PE700       Location/Qualifiers
FT   CDS             complement(848379..849155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_694"
FT                   /old_locus_tag="SAV_694"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_694"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68404"
FT                   /db_xref="GOA:Q82Q27"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q27"
FT                   /protein_id="BAC68404.1"
FT                   /translation="MSSFSLAVRDSSTMLRRNLLHARRYPSLTLNLLLTPVMLLLLFVY
FT                   IFGDTMSGGAGRSAYIAYIVPGILLMTIGSTTIGTAVSVSTDMNEGIIARFRTMAIHRS
FT                   SVLFGHVAGSVLQAIMSVVLVGAVGVAMGFRSTDATVLEWLAAFGLLALFALAFTWIAV
FT                   GMGLGSPNAEAASNNAMPLILLPLISSAFVPLDSMPGWFQPIAEYQPFTPAIETLRGLL
FT                   LGTEIGNNWWIALAWCLGLTVLGHRWSKAQFNRDPK"
     MSSFSLAVRD SSTMLRRNLL HARRYPSLTL NLLLTPVMLL LLFVYIFGDT MSGGAGRSAY        60
     IAYIVPGILL MTIGSTTIGT AVSVSTDMNE GIIARFRTMA IHRSSVLFGH VAGSVLQAIM       120
     SVVLVGAVGV AMGFRSTDAT VLEWLAAFGL LALFALAFTW IAVGMGLGSP NAEAASNNAM       180
     PLILLPLISS AFVPLDSMPG WFQPIAEYQP FTPAIETLRG LLLGTEIGNN WWIALAWCLG       240
     LTVLGHRWSK AQFNRDPK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page