(data stored in ACNUC7421 zone)

EMBL: BA000030.PE707

BA000030.PE707       Location/Qualifiers
FT   CDS             855582..856205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_701"
FT                   /old_locus_tag="SAV_701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_701"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68411"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q20"
FT                   /protein_id="BAC68411.1"
FT                   /translation="MSMRTTFEDRLLGELKREIELREAGVASTGTAEFKTGEGRAKAAV
FT                   GRLFAPLTPRRMAAVAAACTAAWLAAVIMPGSPAGSNAWAVDPVGDGSVKLTVQDQNIS
FT                   VAAQRELARKVRPWGVHVTVDVLAPGYVCERSKVASPLVASDEHGNRVPVIPFKSSWDV
FT                   TLRRGNVLTFENTKGSSQPRAVEFYETRSEAEPCVPMKVVLPDD"
     MSMRTTFEDR LLGELKREIE LREAGVASTG TAEFKTGEGR AKAAVGRLFA PLTPRRMAAV        60
     AAACTAAWLA AVIMPGSPAG SNAWAVDPVG DGSVKLTVQD QNISVAAQRE LARKVRPWGV       120
     HVTVDVLAPG YVCERSKVAS PLVASDEHGN RVPVIPFKSS WDVTLRRGNV LTFENTKGSS       180
     QPRAVEFYET RSEAEPCVPM KVVLPDD                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page