(data stored in ACNUC7421 zone)

EMBL: BA000030.PE718

BA000030.PE718       Location/Qualifiers
FT   CDS             complement(865902..866057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_712"
FT                   /old_locus_tag="SAV_712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_712"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68422"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q09"
FT                   /protein_id="BAC68422.1"
FT                   /translation="MLGTHFPHPTAGRVITHGDAYRLSPVFATPQAWLPRTRVTSNVSE
FT                   LLLIQN"
     MLGTHFPHPT AGRVITHGDA YRLSPVFATP QAWLPRTRVT SNVSELLLIQ N                 51
//

If you have problems or comments...

PBIL Back to PBIL home page