(data stored in ACNUC7421 zone)

EMBL: BA000030.PE72

BA000030.PE72        Location/Qualifiers
FT   CDS             complement(80560..82215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_72"
FT                   /old_locus_tag="SAV_72"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_72"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67781"
FT                   /db_xref="GOA:Q82RS1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RS1"
FT                   /protein_id="BAC67781.1"
FT                   /translation="MTDVPNGRDPNGRDPNGRRALVPASPPGMLRRLQRARLLPRSVRV
FT                   LRSLRVLPRSVRARSALAAAFAAAVLFTSGALLMRHQLYDERLRATSSVAQQQVTTLLS
FT                   ATANSSISGPWGAPYEIVAGDGMLLASSPELEPYEKDGHAFLTGPGRGGSLPLYTRRRF
FT                   TFPAVAEPAARSLSGQTLTTVEGTVPASYLPGETQGRGVAAGARVRVYVLIVPDDAERA
FT                   VGELDRELVVAVPLATALVAGVAWLATRRALRPVEAIRARTASVTAADPRERVEVPDTA
FT                   DEVAELALTINATLQRLEEAATAQRRFVADAAHELRSPLATLLAGLEVATAYPDRADWP
FT                   AVVSAAGRQARRLSGLTEELLLLARLDAGAPPAPAERVDVAALAGRLSEEYAERAGGSP
FT                   KVDLLVAAPDAATTVFAAPGDLERILRNLLDNALRHAVGRVLLTVARDSAAPGSVLCTV
FT                   RDDGAGVAEADSERIFERFTRLDESRTRTDGGTGLGLAIARDLAARHGGLLVLAVQPKG
FT                   SGACFVLRLPAGDPMSIRPRPFKGRGRSARSQRL"
     MTDVPNGRDP NGRDPNGRRA LVPASPPGML RRLQRARLLP RSVRVLRSLR VLPRSVRARS        60
     ALAAAFAAAV LFTSGALLMR HQLYDERLRA TSSVAQQQVT TLLSATANSS ISGPWGAPYE       120
     IVAGDGMLLA SSPELEPYEK DGHAFLTGPG RGGSLPLYTR RRFTFPAVAE PAARSLSGQT       180
     LTTVEGTVPA SYLPGETQGR GVAAGARVRV YVLIVPDDAE RAVGELDREL VVAVPLATAL       240
     VAGVAWLATR RALRPVEAIR ARTASVTAAD PRERVEVPDT ADEVAELALT INATLQRLEE       300
     AATAQRRFVA DAAHELRSPL ATLLAGLEVA TAYPDRADWP AVVSAAGRQA RRLSGLTEEL       360
     LLLARLDAGA PPAPAERVDV AALAGRLSEE YAERAGGSPK VDLLVAAPDA ATTVFAAPGD       420
     LERILRNLLD NALRHAVGRV LLTVARDSAA PGSVLCTVRD DGAGVAEADS ERIFERFTRL       480
     DESRTRTDGG TGLGLAIARD LAARHGGLLV LAVQPKGSGA CFVLRLPAGD PMSIRPRPFK       540
     GRGRSARSQR L                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page