(data stored in ACNUC7421 zone)

EMBL: BA000030.PE84

BA000030.PE84        Location/Qualifiers
FT   CDS             complement(92939..94183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_84"
FT                   /old_locus_tag="SAV_84"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_84"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67793"
FT                   /db_xref="GOA:Q82RQ9"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RQ9"
FT                   /protein_id="BAC67793.1"
FT                   /translation="MATGIKDTAHAVEAAAVMRLLPARPRLLALGEPTHGEDTLLGLRN
FT                   ELFRQLVEQEGYRTIAIESDCLTGLAVDDYVTSGTGTLDEAMEHGFSHGWGTFAANREL
FT                   VRWMRAYNVRAANDGRPACERLRFAGFDGPLEITHAASPRQALTALHSYLATRVDTNLL
FT                   PCTATTLDHLLGTDDRWTHPAAMTDPAQSAGQSAEAGRLRLLADDLVALLDAQTPHLTT
FT                   ATSRDDWDRARLYGRTATGLLRYHYWMADTSPARMTRLVGLRDQMMAHNLLALAARGPA
FT                   LIHAHNSHLQRAKSTMRMGGIPLEWWSAGALVSARLGEEYAFVATALGTIRHQKVDTPP
FT                   PDTVEGLLYALPQDRCVIDAPRLATALGDTRPAPRVSPWFGYAPLDPAHLADSDGIVFV
FT                   KDVVQSRPRLFSKTG"
     MATGIKDTAH AVEAAAVMRL LPARPRLLAL GEPTHGEDTL LGLRNELFRQ LVEQEGYRTI        60
     AIESDCLTGL AVDDYVTSGT GTLDEAMEHG FSHGWGTFAA NRELVRWMRA YNVRAANDGR       120
     PACERLRFAG FDGPLEITHA ASPRQALTAL HSYLATRVDT NLLPCTATTL DHLLGTDDRW       180
     THPAAMTDPA QSAGQSAEAG RLRLLADDLV ALLDAQTPHL TTATSRDDWD RARLYGRTAT       240
     GLLRYHYWMA DTSPARMTRL VGLRDQMMAH NLLALAARGP ALIHAHNSHL QRAKSTMRMG       300
     GIPLEWWSAG ALVSARLGEE YAFVATALGT IRHQKVDTPP PDTVEGLLYA LPQDRCVIDA       360
     PRLATALGDT RPAPRVSPWF GYAPLDPAHL ADSDGIVFVK DVVQSRPRLF SKTG             414
//

If you have problems or comments...

PBIL Back to PBIL home page