(data stored in ACNUC7421 zone)

EMBL: BA000030.PE86

BA000030.PE86        Location/Qualifiers
FT   CDS             complement(95110..96105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_86"
FT                   /old_locus_tag="SAV_86"
FT                   /product="putative erythropoiesis-stimulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_86"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67795"
FT                   /db_xref="GOA:Q82RQ7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RQ7"
FT                   /protein_id="BAC67795.1"
FT                   /translation="MLTTLGLDTAAETVYRTMLMHPQAGVAELAVHLEVPEGDVRDALD
FT                   MLSELALVRMSAEDAGRLRAVSPDIGMEILMARQQAELAAQQQRVEASRAAAAQLISEY
FT                   SELRPATRHPEVEQLVGLDQIRDRLTGLTREVSEELLTFAPGGPQTADNMAASRPLNGD
FT                   LLGRGVRMRTLYLDSVRTDRATVEHARWLTSLGGQVRTVPALPTRLILMDRKTALISVS
FT                   SDDTAAGAVVLTGQGTLTALHALFETTWAGAQPLGDTVPVDRHGLTGQQATVVRLLAEG
FT                   HTDETIAKRLGVSPRTARRIASELMERLEARSRFEAGVRAVQRGWLPARA"
     MLTTLGLDTA AETVYRTMLM HPQAGVAELA VHLEVPEGDV RDALDMLSEL ALVRMSAEDA        60
     GRLRAVSPDI GMEILMARQQ AELAAQQQRV EASRAAAAQL ISEYSELRPA TRHPEVEQLV       120
     GLDQIRDRLT GLTREVSEEL LTFAPGGPQT ADNMAASRPL NGDLLGRGVR MRTLYLDSVR       180
     TDRATVEHAR WLTSLGGQVR TVPALPTRLI LMDRKTALIS VSSDDTAAGA VVLTGQGTLT       240
     ALHALFETTW AGAQPLGDTV PVDRHGLTGQ QATVVRLLAE GHTDETIAKR LGVSPRTARR       300
     IASELMERLE ARSRFEAGVR AVQRGWLPAR A                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page