(data stored in ACNUC7421 zone)

EMBL: BA000030.PE91

BA000030.PE91        Location/Qualifiers
FT   CDS             101447..101893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_91"
FT                   /old_locus_tag="SAV_91"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_91"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67800"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RQ2"
FT                   /protein_id="BAC67800.1"
FT                   /translation="MLEAAQGAPASSGRRTRRPGLSEEVLRAYAYACAFCGYDGMLGRN
FT                   PVGLEAAHIRWHSQDGPDTLANALALCALHHILFGLGVLGLSPGLRIQVSPLYVARSHA
FT                   GHAVGILHRRPLAPPRPGHPSPGPEHIHWHHQQVFKHAPTPVAR"
     MLEAAQGAPA SSGRRTRRPG LSEEVLRAYA YACAFCGYDG MLGRNPVGLE AAHIRWHSQD        60
     GPDTLANALA LCALHHILFG LGVLGLSPGL RIQVSPLYVA RSHAGHAVGI LHRRPLAPPR       120
     PGHPSPGPEH IHWHHQQVFK HAPTPVAR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page