(data stored in ACNUC7421 zone)

EMBL: BA000030.PE95

BA000030.PE95        Location/Qualifiers
FT   CDS             104696..106234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_95"
FT                   /old_locus_tag="SAV_95"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_95"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67804"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RP8"
FT                   /protein_id="BAC67804.1"
FT                   /translation="MLRSPDGRVRVALIRTLRPLAVLAATAALFAGITDLPAAADGTAV
FT                   TKLTLGTDQFKMTDTNYESATNNLYNNVLTNHANLTDVVTTDYTKNSSGATDAWMNLRS
FT                   MRACAGSETQALPPVNKKVAWCWSSAHADDTTPRWFPQGMSTTGTADGGDGAIQGKHVS
FT                   AVAWHYKTFKTNSAGDLEANDGCKTNNLLKVSFIDRDTGKYRHVLLAEPTSTSSSASNF
FT                   KFVTGHGGGIVWYANYLYVTDTANGIRVFDINKLAKVDTYGSGLNSYGVSGGNSSACGY
FT                   PYVLPEVHYYKQASTPASCSTNAVDGTPDADALCYSWLSLDKTGAGPFKLVTGEWYGNV
FT                   AGGRVVRYQLNPTSASAYPGLLNMSGGKTVIQDAYAASGYQGLQGGMTWTDDAGLLNFA
FT                   FSKGCGTKPAVFSHTWAGDTRAVTSCAAGGNWAVGSPQALSYWPKLDTAQVDELWGLTE
FT                   GICAGTSLRASYPYEFPAVSESGNACTGYNSSDNLSLRSVFAVGFTDPAVQNLH"
     MLRSPDGRVR VALIRTLRPL AVLAATAALF AGITDLPAAA DGTAVTKLTL GTDQFKMTDT        60
     NYESATNNLY NNVLTNHANL TDVVTTDYTK NSSGATDAWM NLRSMRACAG SETQALPPVN       120
     KKVAWCWSSA HADDTTPRWF PQGMSTTGTA DGGDGAIQGK HVSAVAWHYK TFKTNSAGDL       180
     EANDGCKTNN LLKVSFIDRD TGKYRHVLLA EPTSTSSSAS NFKFVTGHGG GIVWYANYLY       240
     VTDTANGIRV FDINKLAKVD TYGSGLNSYG VSGGNSSACG YPYVLPEVHY YKQASTPASC       300
     STNAVDGTPD ADALCYSWLS LDKTGAGPFK LVTGEWYGNV AGGRVVRYQL NPTSASAYPG       360
     LLNMSGGKTV IQDAYAASGY QGLQGGMTWT DDAGLLNFAF SKGCGTKPAV FSHTWAGDTR       420
     AVTSCAAGGN WAVGSPQALS YWPKLDTAQV DELWGLTEGI CAGTSLRASY PYEFPAVSES       480
     GNACTGYNSS DNLSLRSVFA VGFTDPAVQN LH                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page