(data stored in ACNUC7421 zone)

EMBL: BA000030.PE96

BA000030.PE96        Location/Qualifiers
FT   CDS             106628..107440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_96"
FT                   /old_locus_tag="SAV_96"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_96"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67805"
FT                   /db_xref="GOA:Q82RP7"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RP7"
FT                   /protein_id="BAC67805.1"
FT                   /translation="MAGQDVRGILPEGLGAAVRDTAEEIAALLRGGADMGRGVPGSQWT
FT                   VGQAAAHLAQAGELMADIAAGRARSWGDGTPQSLAAANERALAAFGERRAEPLAAMIVA
FT                   QADACVTALEESAAGAALVSPLGPMGPGVLGSYLLTHMLGHGYDLARALGCAHMIDRAR
FT                   VELTLPFLITAMPRVSEPARTAGLSASYAIRLWGGGRFGVRVAGGAVAVGPRPPDRPDC
FT                   TILIEPVTFLLMALGRRGQWSAIAQGRILAWGRRPWLAPRFPALFTAP"
     MAGQDVRGIL PEGLGAAVRD TAEEIAALLR GGADMGRGVP GSQWTVGQAA AHLAQAGELM        60
     ADIAAGRARS WGDGTPQSLA AANERALAAF GERRAEPLAA MIVAQADACV TALEESAAGA       120
     ALVSPLGPMG PGVLGSYLLT HMLGHGYDLA RALGCAHMID RARVELTLPF LITAMPRVSE       180
     PARTAGLSAS YAIRLWGGGR FGVRVAGGAV AVGPRPPDRP DCTILIEPVT FLLMALGRRG       240
     QWSAIAQGRI LAWGRRPWLA PRFPALFTAP                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page