(data stored in ACNUC7421 zone)

EMBL: BA000030.PNTB

BA000030.PNTB        Location/Qualifiers
FT   CDS             complement(479883..481349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="SAVERM_403"
FT                   /old_locus_tag="SAV_403"
FT                   /product="putative pyridine nucleotide transhydrogenase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_403"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68112"
FT                   /db_xref="GOA:Q82QU2"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU2"
FT                   /protein_id="BAC68112.1"
FT                   /translation="MTSLKASHAADLVAALLFILSLAGLSQHRTSRAGVVYGIAGMALA
FT                   LVATVVVAARSITAGAVALIVLAMALGAAMGLWRARRVEMTQMPELIAVLHSFVGLAAV
FT                   LVGWNSYLEVDSHGSAQTRIGANLLGIHHAEVFIGIFIGAVTFTGSIVAFLKLSARIKS
FT                   RPLMLPGKNALNLGALAAFVVLTIWFAISPNLPLMIAVTALALALGWHLVASIGGGDMP
FT                   VVVSMLNSYSGWAAAAAGFLLDNNLLIVTGALVGSSGAYLSYIMCKAMNRSFLSVIAGG
FT                   FGIAAPSGGEEEQGEHREVRAAEAAEMLAQARSVIITPGYGMAVAQAQHPVAELTRQLC
FT                   ERGIEVRFGVHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTSVVLVIGANDT
FT                   VNPAATEDPGSPIAGMPVLRVWEAEQVIVFKRSMASGYAGVQNPLFFRENSSMLFGDAK
FT                   QSVEEILHALSTDSRHDAAPAARQATVASH"
     MTSLKASHAA DLVAALLFIL SLAGLSQHRT SRAGVVYGIA GMALALVATV VVAARSITAG        60
     AVALIVLAMA LGAAMGLWRA RRVEMTQMPE LIAVLHSFVG LAAVLVGWNS YLEVDSHGSA       120
     QTRIGANLLG IHHAEVFIGI FIGAVTFTGS IVAFLKLSAR IKSRPLMLPG KNALNLGALA       180
     AFVVLTIWFA ISPNLPLMIA VTALALALGW HLVASIGGGD MPVVVSMLNS YSGWAAAAAG       240
     FLLDNNLLIV TGALVGSSGA YLSYIMCKAM NRSFLSVIAG GFGIAAPSGG EEEQGEHREV       300
     RAAEAAEMLA QARSVIITPG YGMAVAQAQH PVAELTRQLC ERGIEVRFGV HPVAGRLPGH       360
     MNVLLAEAKV PYDIVLEMDE INDDFADTSV VLVIGANDTV NPAATEDPGS PIAGMPVLRV       420
     WEAEQVIVFK RSMASGYAGV QNPLFFRENS SMLFGDAKQS VEEILHALST DSRHDAAPAA       480
     RQATVASH                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page