(data stored in ACNUC7421 zone)

EMBL: BA000030.PRPB1

BA000030.PRPB1       Location/Qualifiers
FT   CDS             complement(379220..380458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB1"
FT                   /locus_tag="SAVERM_321"
FT                   /old_locus_tag="SAV_321"
FT                   /product="putative magnesium or manganese-dependent protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_321"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68030"
FT                   /db_xref="GOA:Q82R24"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R24"
FT                   /protein_id="BAC68030.1"
FT                   /translation="MTLAGTLAAAEAAAPVESLDVVARMLKEHLGAASVSFLITDFTGG
FT                   SVVRLGAAGSVETDEPAQRITLRGTLYDDVIRTQRPSVEAKGQGALVRIVAPVTNRGDA
FT                   IGLLELFLPAAPDAEVMREIGETAHALAYIVIANRSFTDVYQWGRRTTPLSLAAEIQHR
FT                   LLPASLACEAAQFAVAGALEPADHVGGDTFDYVIDRDTVQLSVTDAMGHDVDAALLATL
FT                   AVGALRRARRAGADLAEQARQADQAMREHGHKGYVTGQLLRISLIDGTTEFINAGHPWP
FT                   LRMRNRQVREITPKIDMPFGFHAPHSYQVQSLDLRPGDRLVMLTDGMLERNAGSLDLSD
FT                   LIIRTRALHPREAARTLIAAIVDANDGHLQDDATVMCLDWHGTNHSQRDAATGADLTDA
FT                   SRPSRTGRTTPGR"
     MTLAGTLAAA EAAAPVESLD VVARMLKEHL GAASVSFLIT DFTGGSVVRL GAAGSVETDE        60
     PAQRITLRGT LYDDVIRTQR PSVEAKGQGA LVRIVAPVTN RGDAIGLLEL FLPAAPDAEV       120
     MREIGETAHA LAYIVIANRS FTDVYQWGRR TTPLSLAAEI QHRLLPASLA CEAAQFAVAG       180
     ALEPADHVGG DTFDYVIDRD TVQLSVTDAM GHDVDAALLA TLAVGALRRA RRAGADLAEQ       240
     ARQADQAMRE HGHKGYVTGQ LLRISLIDGT TEFINAGHPW PLRMRNRQVR EITPKIDMPF       300
     GFHAPHSYQV QSLDLRPGDR LVMLTDGMLE RNAGSLDLSD LIIRTRALHP REAARTLIAA       360
     IVDANDGHLQ DDATVMCLDW HGTNHSQRDA ATGADLTDAS RPSRTGRTTP GR               412
//

If you have problems or comments...

PBIL Back to PBIL home page