(data stored in ACNUC7421 zone)

EMBL: BA000030.PRPC1

BA000030.PRPC1       Location/Qualifiers
FT   CDS             complement(851975..853549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC1"
FT                   /locus_tag="SAVERM_698"
FT                   /old_locus_tag="SAV_698"
FT                   /product="putative magnesium or manganese-dependent protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_698"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68408"
FT                   /db_xref="GOA:Q82Q23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q23"
FT                   /protein_id="BAC68408.1"
FT                   /translation="MTAVGRPGDSLAQYRPGAGGSRRAPGEAREEPADDRSPPPAGHRT
FT                   APSRPAPRGRHRAVDRATSPPRRRRNGAPAPSASGGRHAVRSVLMLRSVEDIGPPRPRM
FT                   RTGRKRVRPELDYRLLFGATPSPYLVLAPDLVIVDVNEAYLRATGRTREDLVGQHVFEA
FT                   FPDNPADPDADGVRNLGASLERVLATGSADVMAVQKYDIPVVARPGVFEERWWSPVNTP
FT                   VVDRDGHVAWIIHRVEDVTAFVQARRFRSRGEGGRLSEREEGMEAELYARARELQRLNE
FT                   ELRAAHAREREVAVTLQEAMLHSPDLARHENVAVRYLPAIGSLNVCGDWYDTVDLTEGR
FT                   FTVAVGDVVGHGLEAATIMGMLRSALSAASRGVAGPAQALEVLGMYARSVEGALAATAV
FT                   TVLIDSRSKLLVYSSAGHPPPVLLHADGTCELLDKATDPPLGARPEPVPRPQASAPYRR
FT                   GDALVLYTDGLIERRGEDIDTGLDRLGETLGGLTDLVPERLADALLAGLGVAGGGRDDI
FT                   ALVVVRL"
     MTAVGRPGDS LAQYRPGAGG SRRAPGEARE EPADDRSPPP AGHRTAPSRP APRGRHRAVD        60
     RATSPPRRRR NGAPAPSASG GRHAVRSVLM LRSVEDIGPP RPRMRTGRKR VRPELDYRLL       120
     FGATPSPYLV LAPDLVIVDV NEAYLRATGR TREDLVGQHV FEAFPDNPAD PDADGVRNLG       180
     ASLERVLATG SADVMAVQKY DIPVVARPGV FEERWWSPVN TPVVDRDGHV AWIIHRVEDV       240
     TAFVQARRFR SRGEGGRLSE REEGMEAELY ARARELQRLN EELRAAHARE REVAVTLQEA       300
     MLHSPDLARH ENVAVRYLPA IGSLNVCGDW YDTVDLTEGR FTVAVGDVVG HGLEAATIMG       360
     MLRSALSAAS RGVAGPAQAL EVLGMYARSV EGALAATAVT VLIDSRSKLL VYSSAGHPPP       420
     VLLHADGTCE LLDKATDPPL GARPEPVPRP QASAPYRRGD ALVLYTDGLI ERRGEDIDTG       480
     LDRLGETLGG LTDLVPERLA DALLAGLGVA GGGRDDIALV VVRL                        524
//

If you have problems or comments...

PBIL Back to PBIL home page