(data stored in ACNUC7421 zone)

EMBL: BA000030.PRPI1

BA000030.PRPI1       Location/Qualifiers
FT   CDS             719128..720147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpI1"
FT                   /locus_tag="SAVERM_568"
FT                   /old_locus_tag="SAV_568"
FT                   /product="putative magnesium or manganese-dependent protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_568"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68278"
FT                   /db_xref="GOA:Q82QE1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QE1"
FT                   /protein_id="BAC68278.1"
FT                   /translation="MVGDVVGHGIHAAATMGRLRTAVRTLADIDLPPDELLTHLDDVVI
FT                   RLSAEVSSEASAQTDTESAGDIGATCLYAVYDPVAGRCTLARAGHVLPVVMARDGIADI
FT                   LELPAGPPLGLGGLPFEAAEIDLPEGSLIALYTDGLVEALDHDIEAGLTRLCHALAQPS
FT                   ASLEATCDTALDALLPAGRPHDDVALLLARTHTLGERQVVTWDVDADPAEVARARAHVS
FT                   EQLTTWGLEELDFTTELVVSELVTNAIRYGRPPIQLRLIHDRTLMCEVADAGSTTPHLR
FT                   RARVFDEGGRGLFLVAQLAEHWGTRHARRGKTVWAECALGAPELFSTGLDLEGIPGVV"
     MVGDVVGHGI HAAATMGRLR TAVRTLADID LPPDELLTHL DDVVIRLSAE VSSEASAQTD        60
     TESAGDIGAT CLYAVYDPVA GRCTLARAGH VLPVVMARDG IADILELPAG PPLGLGGLPF       120
     EAAEIDLPEG SLIALYTDGL VEALDHDIEA GLTRLCHALA QPSASLEATC DTALDALLPA       180
     GRPHDDVALL LARTHTLGER QVVTWDVDAD PAEVARARAH VSEQLTTWGL EELDFTTELV       240
     VSELVTNAIR YGRPPIQLRL IHDRTLMCEV ADAGSTTPHL RRARVFDEGG RGLFLVAQLA       300
     EHWGTRHARR GKTVWAECAL GAPELFSTGL DLEGIPGVV                              339
//

If you have problems or comments...

PBIL Back to PBIL home page