(data stored in ACNUC7421 zone)

EMBL: BA000030.PRPL1

BA000030.PRPL1       Location/Qualifiers
FT   CDS             739502..741964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpL1"
FT                   /locus_tag="SAVERM_586"
FT                   /old_locus_tag="SAV_586"
FT                   /product="putative magnesium or manganese-dependent protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_586"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68296"
FT                   /db_xref="GOA:Q82QC4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QC4"
FT                   /protein_id="BAC68296.1"
FT                   /translation="MTKTDHTPLAEPVSPRETPDAAIAMLDAEGTVVGWTHAAEQLVGY
FT                   SAGEVVGRSATHVLPPAEDVPSASVFAEQGRALDGWSGAVTVRHRDGHAIKMTLRISLL
FT                   WGQDAGTRWLVSVTDIGTLSSGTSDEAVRESLLAHAPVGIAVYDPRLRCTWVNDVMERH
FT                   DGTPRERRFGRRLRDSLPAVEAEALEVVMRQVLESGTTMVHEYRAWSSTDQRREHAFSA
FT                   SFFCLQDADGTALAVCSMSVDVTGNRRARERLAILSEASTRIGSTLEVMRTGQELADLA
FT                   VPLLADHAIVDLMESVPFGVDPSAGTGTAANDRPPVLRRAGVASVDPGILKLLMRQEVI
FT                   RPFPTSLFATVLRTGRSYLESVLDTYSGPWILHDPARTQMVRDSGVHSLMVVPIRARRC
FT                   ALGLAVFCRSEEPTPFQEDDLLLAEELVTRAALSLDNALQYARQRTAALTLQRDLLPHH
FT                   VGGGAALDVASRYVPADIDHGVGGDWFDVIKLSGARVALVVGDVVGHGINAAVTMGRLR
FT                   TAVRTLANMELPPHELLAHLDDTVKRLSEEDADAPDQLPPAVGATCLYAVYDPVTRRCT
FT                   MSRAGHPPPAIIDPQGRATFPDMPAGAPLGLGLGLVPFESVELELPEGTLLALYTDGLV
FT                   ESRDDDIDVGLDRLGAALAESGSALEDLCSQVIETLPTQAPADDVTLLLARTRGLEPAQ
FT                   VASWELPNEPAAVRIARQAAARQLSEWGLDHLVTTEQLIVSELVTNAIRYSGGPIRLRL
FT                   IQHQVLTCEVSDSNPSHPRPRQPHTIDENGRGLSLVAQLSHRWGSRSATDGKIVWAEQD
FT                   LPSKALAA"
     MTKTDHTPLA EPVSPRETPD AAIAMLDAEG TVVGWTHAAE QLVGYSAGEV VGRSATHVLP        60
     PAEDVPSASV FAEQGRALDG WSGAVTVRHR DGHAIKMTLR ISLLWGQDAG TRWLVSVTDI       120
     GTLSSGTSDE AVRESLLAHA PVGIAVYDPR LRCTWVNDVM ERHDGTPRER RFGRRLRDSL       180
     PAVEAEALEV VMRQVLESGT TMVHEYRAWS STDQRREHAF SASFFCLQDA DGTALAVCSM       240
     SVDVTGNRRA RERLAILSEA STRIGSTLEV MRTGQELADL AVPLLADHAI VDLMESVPFG       300
     VDPSAGTGTA ANDRPPVLRR AGVASVDPGI LKLLMRQEVI RPFPTSLFAT VLRTGRSYLE       360
     SVLDTYSGPW ILHDPARTQM VRDSGVHSLM VVPIRARRCA LGLAVFCRSE EPTPFQEDDL       420
     LLAEELVTRA ALSLDNALQY ARQRTAALTL QRDLLPHHVG GGAALDVASR YVPADIDHGV       480
     GGDWFDVIKL SGARVALVVG DVVGHGINAA VTMGRLRTAV RTLANMELPP HELLAHLDDT       540
     VKRLSEEDAD APDQLPPAVG ATCLYAVYDP VTRRCTMSRA GHPPPAIIDP QGRATFPDMP       600
     AGAPLGLGLG LVPFESVELE LPEGTLLALY TDGLVESRDD DIDVGLDRLG AALAESGSAL       660
     EDLCSQVIET LPTQAPADDV TLLLARTRGL EPAQVASWEL PNEPAAVRIA RQAAARQLSE       720
     WGLDHLVTTE QLIVSELVTN AIRYSGGPIR LRLIQHQVLT CEVSDSNPSH PRPRQPHTID       780
     ENGRGLSLVA QLSHRWGSRS ATDGKIVWAE QDLPSKALAA                             820
//

If you have problems or comments...

PBIL Back to PBIL home page