(data stored in ACNUC7421 zone)

EMBL: BA000030.RPOA2

BA000030.RPOA2       Location/Qualifiers
FT   CDS             594232..595248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA2"
FT                   /locus_tag="SAVERM_440"
FT                   /old_locus_tag="SAV_440"
FT                   /product="putative RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_440"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68150"
FT                   /db_xref="GOA:Q82QR5"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q82QR5"
FT                   /protein_id="BAC68150.1"
FT                   /translation="MLIAQRPSLTEEVVDEFRSRFVIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGAAVTSIRVDGVLHEFTTVPGVKEDVTDLILNIKQLVVSSEHDEPVVMYLRKQGPGL
FT                   VTAADIAPPAGVEVHNPDLVLATLNGKGKLEMELTVERGRGYVSAVQNKQVGQEIGRIP
FT                   VDSIYSPVLKVTYKVEATRVEQRTDFDKLIVDVETKQAMRPRDAMASAGKTLVELFGLA
FT                   RELNIDAEGIDMGPSPVDAALAADLVMPIEELELTVRSYNCLKREGVHSVGELVARSEA
FT                   DLLDIRNFGAKSIDEVKAKLAGMGLGLKDSPPGFDPTAAALGADDDADAGFLETEHY"
     MLIAQRPSLT EEVVDEFRSR FVIEPLEPGF GYTLGNSLRR TLLSSIPGAA VTSIRVDGVL        60
     HEFTTVPGVK EDVTDLILNI KQLVVSSEHD EPVVMYLRKQ GPGLVTAADI APPAGVEVHN       120
     PDLVLATLNG KGKLEMELTV ERGRGYVSAV QNKQVGQEIG RIPVDSIYSP VLKVTYKVEA       180
     TRVEQRTDFD KLIVDVETKQ AMRPRDAMAS AGKTLVELFG LARELNIDAE GIDMGPSPVD       240
     AALAADLVMP IEELELTVRS YNCLKREGVH SVGELVARSE ADLLDIRNFG AKSIDEVKAK       300
     LAGMGLGLKD SPPGFDPTAA ALGADDDADA GFLETEHY                               338
//

If you have problems or comments...

PBIL Back to PBIL home page