(data stored in ACNUC7421 zone)

EMBL: BA000030.WAPA

BA000030.WAPA        Location/Qualifiers
FT   CDS             complement(598312..600774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wapA"
FT                   /locus_tag="SAVERM_444"
FT                   /old_locus_tag="SAV_444"
FT                   /product="putative cell wall-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_444"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68154"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QR1"
FT                   /protein_id="BAC68154.1"
FT                   /translation="MAGQGQHRPHRRLPPDANGNLASTTDTEGKTTVFRYDAWGRVDKI
FT                   TTAEGRVTVFTYDDANRVTSMLRGTGFNSDGHTGPTWTYAYTSDSVTAAGTTTATDPET
FT                   HATKYQHDSDGQVSDVTDAMGHKRSTKFDANHSIDTSTDAMGSGTTPGNVTDYGFNTRN
FT                   NLETITQPTGGKTVNHWQTIAGADVPKDSTNPDGEKTDFTYDAVGNTMSVAQTGTGGGN
FT                   VSYTYNPASPTCGGFAGQRCTEKTKMTAAKTVTTTFHYDSAGNLDTVTPPAPLAKITYT
FT                   YDALGRTKTVTDARGVTVTYTYDNRDRTRIVDTTNKARVEYWYDGDGNLTQRTDSTGTI
FT                   KYDFDPLQRETIRTLQDGSQTLLAYTPSGNVDYYQDPAGTVDYTWNEVNKLAELKDPAG
FT                   RVTTYKYNNNDVRTTTTYPGGTVQKVDPDNSSRPKTIKTTSPKGTPVDLAYSYGYGTSG
FT                   TTEGSKIRSSTDNVTGLKTTYTYDGAGRFSYAEEKKGTTLNSSWLYCYDLAGNLTSQGT
FT                   AAGCPGATTYTVNDAQQLTAKNGSTTNWSYDKIGNETAGASTPEGTRTAEKWTDHSQLT
FT                   SLTVGGKTYTGQYGSTDQSERIRLGDTYFHNGPIGLAGTSTAGVDTGFNREPGGTLNSM
FT                   TTGGKAYCYLTDALGSVIALTDETGAKVNTYAYSPRGVTRASTSEKNPQPYRFAGGYQD
FT                   VTGLYHYGARYYDPNIGRFNSPDPSGQEENPYLYAEGDPVNRIDPNGLFSFSDALDTGS
FT                   DIFGVVTGCLAGVTAAAETGSIAYAAAVGGVVGAGVGSAVGVGLAVVGSCALGGAAGFY
FT                   GAEILTYG"
     MAGQGQHRPH RRLPPDANGN LASTTDTEGK TTVFRYDAWG RVDKITTAEG RVTVFTYDDA        60
     NRVTSMLRGT GFNSDGHTGP TWTYAYTSDS VTAAGTTTAT DPETHATKYQ HDSDGQVSDV       120
     TDAMGHKRST KFDANHSIDT STDAMGSGTT PGNVTDYGFN TRNNLETITQ PTGGKTVNHW       180
     QTIAGADVPK DSTNPDGEKT DFTYDAVGNT MSVAQTGTGG GNVSYTYNPA SPTCGGFAGQ       240
     RCTEKTKMTA AKTVTTTFHY DSAGNLDTVT PPAPLAKITY TYDALGRTKT VTDARGVTVT       300
     YTYDNRDRTR IVDTTNKARV EYWYDGDGNL TQRTDSTGTI KYDFDPLQRE TIRTLQDGSQ       360
     TLLAYTPSGN VDYYQDPAGT VDYTWNEVNK LAELKDPAGR VTTYKYNNND VRTTTTYPGG       420
     TVQKVDPDNS SRPKTIKTTS PKGTPVDLAY SYGYGTSGTT EGSKIRSSTD NVTGLKTTYT       480
     YDGAGRFSYA EEKKGTTLNS SWLYCYDLAG NLTSQGTAAG CPGATTYTVN DAQQLTAKNG       540
     STTNWSYDKI GNETAGASTP EGTRTAEKWT DHSQLTSLTV GGKTYTGQYG STDQSERIRL       600
     GDTYFHNGPI GLAGTSTAGV DTGFNREPGG TLNSMTTGGK AYCYLTDALG SVIALTDETG       660
     AKVNTYAYSP RGVTRASTSE KNPQPYRFAG GYQDVTGLYH YGARYYDPNI GRFNSPDPSG       720
     QEENPYLYAE GDPVNRIDPN GLFSFSDALD TGSDIFGVVT GCLAGVTAAA ETGSIAYAAA       780
     VGGVVGAGVG SAVGVGLAVV GSCALGGAAG FYGAEILTYG                             820
//

If you have problems or comments...

PBIL Back to PBIL home page